PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16869A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 228aa    MW: 25058 Da    PI: 8.1243
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16869AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.99.9e-135195147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               r +WT  E++++++a +++  + Wk+I +++g  +t  q++s+ qky
  Oropetium_20150105_16869A 51 RESWTDPEHDKFLEALQLFDRD-WKKIEAYVG-SKTVIQIRSHAQKY 95
                               789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-1645101IPR009057Homeodomain-like
PROSITE profilePS5129414.23446100IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-649101IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-184998IPR006447Myb domain, plants
SMARTSM007177.1E-105098IPR001005SANT/Myb domain
PfamPF002492.4E-105195IPR001005SANT/Myb domain
CDDcd001672.11E-75396No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MSATPYSLDS SVPGVGGGGG DAMEEAHLRL REDEEEGARR VRKPYTITKS RESWTDPEHD  60
KFLEALQLFD RDWKKIEAYV GSKTVIQIRS HAQKYFLKVQ KNGTGEHLPP PRPKRKAAHP  120
YPHKALKKTP QVVLPQQASH VMEQGCVTSI DVSAGATDSS ANDGENGPVQ LFNPRHTLGC  180
TARNSYSSGL SSQSGSCPTS EVNEQEIMLP ALHEELARFT WTKHGAR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9634641e-119EU963464.1 Zea mays clone 262971 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964289.11e-105PREDICTED: protein REVEILLE 6-like isoform X2
SwissprotQ8H0W31e-56RVE6_ARATH; Protein REVEILLE 6
TrEMBLK3XYA01e-105K3XYA0_SETIT; Uncharacterized protein
TrEMBLK3XYM91e-105K3XYM9_SETIT; Uncharacterized protein
STRINGSi006883m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP109638111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.13e-44MYB_related family protein